PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03698.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family ARF
Protein Properties Length: 1174aa    MW: 129852 Da    PI: 6.8858
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03698.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.41.3e-23127228199
                              EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EE CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfv 80 
                              f+k+lt sd++++g +++p++ ae++      +++++++ +l+ +d + ++W++++i+r++++r++lt+GW+ Fv+ ++L +gD+v
  Rsa1.0_03698.1_g00001.1 127 FCKTLTASDTSTHGGFSVPRRAAEKIfpaldfSMQPPCQ-ELVAKDIHDNTWTFRHIFRGQPKRHLLTTGWSVFVSTKRLLAGDSV 211
                              99*****************************98888885.9********************************************* PP

                              EEEE-SSSEE..EEEEE-S CS
                       B3  81 vFkldgrsefelvvkvfrk 99 
                              +F +  + +++l+++++r+
  Rsa1.0_03698.1_g00001.1 212 LFVR--DGKGQLLLGIRRA 228
                              ***5..468889****997 PP

2Auxin_resp116.71.9e-38253335183
               Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                              aaha +++s+F+++YnPra+++eFvv+++k+ ka++ +vs+GmRf+m fete++  rr++Gtv+g++dldpvrW+nS+Wr+L+
  Rsa1.0_03698.1_g00001.1 253 AAHANANNSPFTIFYNPRAAPAEFVVPLAKYTKAMYAQVSLGMRFRMIFETEECGVRRYMGTVTGITDLDPVRWKNSQWRNLQ 335
                              799******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.49E-42117256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.1E-41121242IPR015300DNA-binding pseudobarrel domain
CDDcd100175.36E-21126227No hitNo description
PfamPF023621.2E-21127228IPR003340B3 DNA binding domain
PROSITE profilePS5086312.421127229IPR003340B3 DNA binding domain
SMARTSM010192.3E-23127229IPR003340B3 DNA binding domain
PfamPF065071.7E-33253335IPR010525Auxin response factor
PfamPF023093.1E-910451133IPR033389AUX/IAA domain
PROSITE profilePS5174526.17410471140IPR000270PB1 domain
SuperFamilySSF542771.08E-810601125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009638Biological Processphototropism
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009785Biological Processblue light signaling pathway
GO:0010311Biological Processlateral root formation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1174 aa     Download sequence    Send to blast
MKAPSSNGVS PNPLEGERRN INSELWHACA GPLISLPPAG SLVVYFPQGH SEQVAASMQK  60
QTDFIPSYPN LPSKLICMLQ NVTLNADPET EEVYAQMTLQ PVNKYDREAL LASDMGLKLN  120
RQPNEFFCKT LTASDTSTHG GFSVPRRAAE KIFPALDFSM QPPCQELVAK DIHDNTWTFR  180
HIFRGQPKRH LLTTGWSVFV STKRLLAGDS VLFVRDGKGQ LLLGIRRANR QQPALSSSVI  240
SSDSMHIGVL AAAAHANANN SPFTIFYNPR AAPAEFVVPL AKYTKAMYAQ VSLGMRFRMI  300
FETEECGVRR YMGTVTGITD LDPVRWKNSQ WRNLQIGWDE SAAGDRPSRV SVWDIEPVLT  360
PFYICPPPFF RPRFAGQPGM PDDGTDMESA LKRAMPWLDN GLEMKDPSST IFPGLSLVQW  420
MSMQQQNGQV PGAAAQPGFF PSMLSPSAAL HNNLGGTDDP SKLLSFQTPP GGISSSNLQF  480
NKPNPQAAMS QLPQPPTTLS QQQQLQQLLH SSLNHQQQQS QPQQPQSLQQ QQQQQSLQQQ  540
QQSLLQQQQQ QQQSLQQHHQ QPLQQQTQQQ QLQQQNQQQQ IQQQQQLRSQ QLQSQPQSHP  600
QHMLQQFQIP QNQLYSGQQA AQQHQTQQAS MHHLQPQVVS GSIASSVIAP PSSSLNQSFQ  660
QQQQSTQPQH THRHIGGSTS QSSVIETSKS SSNLMSKPPQ DTQFSRQMEQ QQPSGLVQGH  720
NQQTLVQQKT QQSQVQQRFQ QSLLEQPHLQ FQLLQRLQQQ QQQQQQQQQF LSPGSSSLQS  780
QLLHQQLQSQ QLQQLPSISQ SQQFPSSCTN TGLPSLQPPQ MLVSRPQDKQ NPPVGGGAKA  840
YSGITDGGDA PSSSTSPSTN NCQISSSTFL NRSQSGPAIL IPDPAVDVSA SLVQDLYSKS  900
DMRLKHELVS QQKPKASLTD HQLEASASGT SYGLDGGENS RQQNFLSPNF GLDGDSRNSL  960
FGGANVENGF VPETLLSRGY DSQKDLQNML SNYGGVTNDI GTEMSTSAVR TQSFGIPNVP  1020
AISNDLAVND AGVLGGGLWP TQAQRMRTYT KVQKRGSVGR SIDVNRYRGY DELRHDLARM  1080
FGIEGQLEDP LTSDWKLVYV DHENDILLVG DDPWEEFVNC VQSIKILSSA EVQQMSLDGN  1140
FAGLPATNQA CSGGDNGNGW RGQYDDNSAN SFNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1652135651388Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794690.0JN979469.1 Brassica rapa subsp. pekinensis auxin response factor 7-1 (ARF7-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM4CDP60.0M4CDP6_BRARP; Auxin response factor
STRINGBra002327.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26292665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20730.20.0ARF family protein